- coiled-coil domain containing 53 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-84521
- This antibody was developed against Recombinant Protein corresponding to amino acids: LMGSGIDLTK VPAIQQKRTV AFLNQFVVHT VQFLNRFSTV CEEKLADLSL RIQQIETTLN ILDAKLSSIP GLDDVTVEVS P
- 0.1 ml (also 25ul)
- coiled-coil domain containing 53
- Human
- Unconjugated
- Rabbit
- Immunohistochemistry, Immunohistochemistry-Paraffin
- CCDC53, CGI-116
- PBS (pH 7.2) and 40% Glycerol
- WASH complex subunit 3
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
LMGSGIDLTKVPAIQQKRTVAFLNQFVVHTVQFLNRFSTVCEEKLADLSLRIQQIETTLNILDAKLSSIPGLDDVTVEVSP
Specifications/Features
Available conjugates: Unconjugated